PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P16870_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 284aa    MW: 32577.9 Da    PI: 10.2207
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P16870_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF991.9e-3158107150
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                 SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                            krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  GSMUA_Achr5P16870_001  58 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 107
                            79***********************************************8 PP

2K-box109.63.4e-361282235100
                  K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                            sg  ++ + + ++qqe+akL+ +i+ Lq+ +Rhl+G+ L+sL++keL+qLe++Le+s+++iRskK+ell+++ie++qk+e elq++n+
  GSMUA_Achr5P16870_001 128 SGAIVDVNSQHYYQQESAKLRHQIQILQNANRHLMGDALSSLNVKELKQLENRLERSITRIRSKKHELLFAEIEYMQKREVELQSDNM 215
                            344477788899**************************************************************************** PP

                  K-box  93 aLrkklee 100
                            +Lr+k++e
  GSMUA_Achr5P16870_001 216 YLRAKIAE 223
                            *****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-4250109IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.1650110IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-3351122IPR002100Transcription factor, MADS-box
CDDcd002651.40E-4451127No hitNo description
PRINTSPR004046.3E-335272IPR002100Transcription factor, MADS-box
PROSITE patternPS00350052106IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2659106IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-337287IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-3387108IPR002100Transcription factor, MADS-box
PfamPF014861.6E-27135221IPR002487Transcription factor, K-box
PROSITE profilePS5129715.329137227IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MQRLLCLFSS PPPSLGGIRR LRARRSPSRR RSFFRGERSS ASVQRTSTKM GRGKIEIKRI  60
ENTTNRQVTF CKRRNGLLKK AYELSVLCDA EVALIVFSSR GRLYEYANNN IKSTIERYKK  120
ACADSSSSGA IVDVNSQHYY QQESAKLRHQ IQILQNANRH LMGDALSSLN VKELKQLENR  180
LERSITRIRS KKHELLFAEI EYMQKREVEL QSDNMYLRAK IAENERVQQL SIVEAGAEYD  240
AIPGAFDSRN YYHANMLEAA AHYSHHQDQT ALQLGYETKA DSAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-2150118169Myocyte-specific enhancer factor 2B
1tqe_Q2e-2150118169Myocyte-specific enhancer factor 2B
1tqe_R2e-2150118169Myocyte-specific enhancer factor 2B
1tqe_S2e-2150118169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8693100.0EU869310.1 Musa acuminata AAA Group MADS-box protein MADS5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009401103.11e-173PREDICTED: MADS-box transcription factor 3-like
SwissprotQ407041e-109MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLM0SZ660.0M0SZ66_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P16870_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-108MIKC_MADS family protein